Lineage for d3sirb_ (3sir B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2854798Fold c.17: Caspase-like [52128] (1 superfamily)
    3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest
  4. 2854799Superfamily c.17.1: Caspase-like [52129] (3 families) (S)
    mature protein may be composed of two chains folded in a single domain
  5. 2854800Family c.17.1.1: Caspase catalytic domain [52130] (8 proteins)
  6. 2854926Protein automated matches [190398] (2 species)
    not a true protein
  7. 2854927Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [196246] (1 PDB entry)
  8. 2854929Domain d3sirb_: 3sir B: [200669]
    automated match to d3sird_

Details for d3sirb_

PDB Entry: 3sir (more details), 2.68 Å

PDB Description: crystal structure of drice
PDB Compounds: (B:) Caspase

SCOPe Domain Sequences for d3sirb_:

Sequence, based on SEQRES records: (download)

>d3sirb_ c.17.1.1 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
aaeynmrhknrgmalifnhehfevptlksragtnvdcenltrvlkqldfevtvykdcryk
dilrtieysasqnhsdsdcilvailshgemgyiyakdtqykldniwsfftanhcpslagk
pklffiqacqgdrldggvtmqrsqtetdgdssmsykipvhadfliaystvpgfyswrntt
rgswfmqslcaelaangkrldiltlltfvcqrvavdfesctpdtpemhqqkqipcittml
trilrfs

Sequence, based on observed residues (ATOM records): (download)

>d3sirb_ c.17.1.1 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
aaeynmrhknrgmalifnnvdcenltrvlkqldfevtvykdcrykdilrtieysasqnhs
dsdcilvailshiwsfftanhcpslagkpklffiqacsykipvhadfliaystvptrgsw
fmqslcaelaangkrldiltlltfvcqrvavdfescqipcittmltrilrfs

SCOPe Domain Coordinates for d3sirb_:

Click to download the PDB-style file with coordinates for d3sirb_.
(The format of our PDB-style files is described here.)

Timeline for d3sirb_: