Lineage for d3shdg_ (3shd G:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2211445Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2211446Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2211807Family d.113.1.0: automated matches [191580] (1 protein)
    not a true family
  6. 2211808Protein automated matches [191036] (16 species)
    not a true protein
  7. 2211857Species Escherichia coli [TaxId:405955] [188925] (4 PDB entries)
  8. 2211872Domain d3shdg_: 3shd G: [200665]
    automated match to d3shdk_
    complexed with mn, so4

Details for d3shdg_

PDB Entry: 3shd (more details), 2.5 Å

PDB Description: Crystal structure of Nudix hydrolase Orf153, ymfB, from Escherichia coli K-1
PDB Compounds: (G:) Phosphatase nudJ

SCOPe Domain Sequences for d3shdg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3shdg_ d.113.1.0 (G:) automated matches {Escherichia coli [TaxId: 405955]}
mfkphvtvacvvhaegkflvveetingkalwnqpaghleadetlveaaarelweetgisa
qpqhfirmhqwiapdktpflrflfaieleqicptqphdsdidccrwvsaeeilqasnlrs
plvaesircyqsgqryplemigdfnwpftk

SCOPe Domain Coordinates for d3shdg_:

Click to download the PDB-style file with coordinates for d3shdg_.
(The format of our PDB-style files is described here.)

Timeline for d3shdg_: