Lineage for d3shdd_ (3shd D:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1428504Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 1428505Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 1428789Family d.113.1.0: automated matches [191580] (1 protein)
    not a true family
  6. 1428790Protein automated matches [191036] (8 species)
    not a true protein
  7. 1428816Species Escherichia coli [TaxId:405955] [188925] (2 PDB entries)
  8. 1428828Domain d3shdd_: 3shd D: [200662]
    automated match to d3shdk_
    complexed with mn, so4

Details for d3shdd_

PDB Entry: 3shd (more details), 2.5 Å

PDB Description: Crystal structure of Nudix hydrolase Orf153, ymfB, from Escherichia coli K-1
PDB Compounds: (D:) Phosphatase nudJ

SCOPe Domain Sequences for d3shdd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3shdd_ d.113.1.0 (D:) automated matches {Escherichia coli [TaxId: 405955]}
mfkphvtvacvvhaegkflvveetingkalwnqpaghleadetlveaaarelweetgisa
qpqhfirmhqwiapdktpflrflfaieleqicptqphdsdidccrwvsaeeilqasnlrs
plvaesircyqsgqryplemigdfnwpftk

SCOPe Domain Coordinates for d3shdd_:

Click to download the PDB-style file with coordinates for d3shdd_.
(The format of our PDB-style files is described here.)

Timeline for d3shdd_: