Lineage for d3sgzb_ (3sgz B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080389Protein automated matches [190228] (18 species)
    not a true protein
  7. 2080458Species Norway rat (Rattus norvegicus) [TaxId:10116] [195883] (2 PDB entries)
  8. 2080460Domain d3sgzb_: 3sgz B: [200658]
    automated match to d3sgzc_
    complexed with fmn, ho6

Details for d3sgzb_

PDB Entry: 3sgz (more details), 1.35 Å

PDB Description: High resolution crystal structure of rat long chain hydroxy acid oxidase in complex with the inhibitor 4-carboxy-5-[(4-chiorophenyl)sulfanyl]-1, 2, 3-thiadiazole.
PDB Compounds: (B:) Hydroxyacid oxidase 2

SCOPe Domain Sequences for d3sgzb_:

Sequence, based on SEQRES records: (download)

>d3sgzb_ c.1.4.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
plvcladfkahaqkqlsktswdfiegeaddgityseniaafkrirlrprylrdmskvdtr
ttiqgqeisapicisptafhsiawpdgekstaraaqeanicyvissyasysledivaaap
egfrwfqlymksdwdfnkqmvqraealgfkalvitidtpvlgnrrrdkrnqlnleanilk
aalralkeekptqsvpvlfpkasfcwndlsllqsitrlpiilkgiltkedaelamkhnvq
givvsnhggrqldevsasidalrevvaavkgkievymdggvrtgtdvlkalalgarcifl
grpilwglackgedgvkevldiltaelhrcmtlsgcqsvaeispdliqf

Sequence, based on observed residues (ATOM records): (download)

>d3sgzb_ c.1.4.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
plvcladfkahaqkqlsktswdfiegeaddgityseniaafkrirlrprylrdmskvdtr
ttiqgqeisapicisptafhsiawpdgekstaraaqeanicyvissyasysledivaaap
egfrwfqlymksdwdfnkqmvqraealgfkalvitidtpvlgnrrrdkrnqlnleanilk
aalfpkasfcwndlsllqsitrlpiilkgiltkedaelamkhnvqgivvsnhggrqldev
sasidalrevvaavkgkievymdggvrtgtdvlkalalgarciflgrpilwglackgedg
vkevldiltaelhrcmtlsgcqsvaeispdliqf

SCOPe Domain Coordinates for d3sgzb_:

Click to download the PDB-style file with coordinates for d3sgzb_.
(The format of our PDB-style files is described here.)

Timeline for d3sgzb_: