SCOPe 2.07: Domain d3sgxb_: 3sgx B:

Lineage for d3sgxb_ (3sgx B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156

4. Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families)
   the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase

5. Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (2 proteins)
   automatically mapped to Pfam PF01255

6. Protein Undecaprenyl diphosphate synthase [64007] (3 species)

7. Species Escherichia coli [TaxId:562] [64009] (17 PDB entries)

8. Domain d3sgxb_: 3sgx B: [200655]
   automated match to d1ueha_
   complexed with 0fw

Details for d3sgxb_

PDB Entry: 3sgx, 2.45 Å

PDB Description: Crystal Structure of E. coli undecaprenyl pyrophosphate synthase in complex with BPH-1100

PDB Compounds: (B:) undecaprenyl pyrophosphate synthase

SCOPe Domain Sequences for d3sgxb_:

Sequence, based on SEQRES records:

>d3sgxb_ c.101.1.1 (B:) Undecaprenyl diphosphate synthase {Escherichia coli [TaxId: 562]}
gcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafssenwn
rpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntg
ltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtg
gehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafan

Sequence, based on observed residues (ATOM records):

>d3sgxb_ c.101.1.1 (B:) Undecaprenyl diphosphate synthase {Escherichia coli [TaxId: 562]}
gcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafaldsev
kslhrhnvrlriigdtsfnsrlqerirksealtagntgltlniaanyggrwdivqgvrql
aekvqqgnlqpdqideemlnqhvcmhelapvdlvirtggehrisnfllwqiayaelyftd
vlwpdfdeqdfegalnafan

Timeline for d3sgxb_:

• d3sgxb_ first appeared in SCOPe 2.03
  
• d3sgxb_ appears in SCOPe 2.06
  
• d3sgxb_ appears in the current release, SCOPe 2.08