Lineage for d1nmal_ (1nma L:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287738Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 288075Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (146 PDB entries)
  8. 288210Domain d1nmal_: 1nma L: [20064]
    Other proteins in same PDB: d1nmah_, d1nman_
    part of Fab NC10; only Fv coordinates are included
    complexed with man, nag; mutant

Details for d1nmal_

PDB Entry: 1nma (more details), 3 Å

PDB Description: n9 neuraminidase complexes with antibodies nc41 and nc10: empirical free-energy calculations capture specificity trends observed with mutant binding data
PDB Compounds: (L:)

SCOP Domain Sequences for d1nmal_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nmal_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
diqmtqttsslsaslgdrvtiscrasqdisnylnwyqqnpdgtvklliyytsnlhsevps
rfsgsgsgtdysltisnleqediatyfcqqdftlpftfgggtkleirra

SCOP Domain Coordinates for d1nmal_:

Click to download the PDB-style file with coordinates for d1nmal_.
(The format of our PDB-style files is described here.)

Timeline for d1nmal_: