SCOPe 2.08: Domain d3sdk1_: 3sdk 1:

Lineage for d3sdk1_ (3sdk 1:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome beta subunit (catalytic) [56252] (7 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (202 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d3sdk1_: 3sdk 1: [200637]
   Other proteins in same PDB: d3sdkb_, d3sdkd_, d3sdkf_, d3sdkp_, d3sdkr_, d3sdkt_
   automated match to d1rypn_
   complexed with mes, mg, p3n

Details for d3sdk1_

PDB Entry: 3sdk, 2.7 Å

PDB Description: structure of yeast 20s open-gate proteasome with compound 34

PDB Compounds: (1:) Proteasome component PRE4

SCOPe Domain Sequences for d3sdk1_:

Sequence; same for both SEQRES and ATOM records:

>d3sdk1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki

Timeline for d3sdk1_:

• d3sdk1_ first appeared in SCOPe 2.03
  
• d3sdk1_ appears in SCOPe 2.07