SCOPe 2.05: Domain d1nmbh_: 1nmb H:

Lineage for d1nmbh_ (1nmb H:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (178 PDB entries)
   Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor

8. Domain d1nmbh_: 1nmb H: [20063]
   Other proteins in same PDB: d1nmbl_, d1nmbn_
   part of Fab NC10; only Fv coordinates are included
   complexed with ca, nag

Details for d1nmbh_

PDB Entry: 1nmb, 2.2 Å

PDB Description: the structure of a complex between the nc10 antibody and influenza virus neuraminidase and comparison with the overlapping binding site of the nc41 antibody

PDB Compounds: (H:) fab nc10

SCOPe Domain Sequences for d1nmbh_:

Sequence; same for both SEQRES and ATOM records:

>d1nmbh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qvqlqqpgaelvkpgasvrmsckasgytftnynmywvkqspgqglewigifypgngdtsy
nqkfkdkatltadkssntaymqlssltsedsavyycarsggsyrydggfdywgqgttltv
ss

Timeline for d1nmbh_:

• d1nmbh_ first appeared (with stable ids) in SCOP 1.55
  
• d1nmbh_ appears in SCOPe 2.04
  
• d1nmbh_ appears in SCOPe 2.06
  
• d1nmbh_ appears in the current release, SCOPe 2.08, called d1nmbh1