Lineage for d1nmbh_ (1nmb H:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 546556Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 546882Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)
  8. 546998Domain d1nmbh_: 1nmb H: [20063]
    Other proteins in same PDB: d1nmbl_, d1nmbn_
    part of Fab NC10; only Fv coordinates are included
    complexed with ca, man, nag; mutant

Details for d1nmbh_

PDB Entry: 1nmb (more details), 2.5 Å

PDB Description: the structure of a complex between the nc10 antibody and influenza virus neuraminidase and comparison with the overlapping binding site of the nc41 antibody

SCOP Domain Sequences for d1nmbh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nmbh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
qvqlqqpgaelvkpgasvrmsckasgytftnynmywvkqspgqglewigifypgngdtsy
nqkfkdkatltadkssntaymqlssltsedsavyycarsggsyrydggfdywgqgttltv
ss

SCOP Domain Coordinates for d1nmbh_:

Click to download the PDB-style file with coordinates for d1nmbh_.
(The format of our PDB-style files is described here.)

Timeline for d1nmbh_: