Lineage for d1nmbh1 (1nmb H:6-113)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2344816Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2345323Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (184 PDB entries)
    Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor
  8. 2345391Domain d1nmbh1: 1nmb H:6-113 [20063]
    Other proteins in same PDB: d1nmbh2, d1nmbl_, d1nmbn_
    part of Fab NC10; only Fv coordinates are included
    complexed with ca, nag

Details for d1nmbh1

PDB Entry: 1nmb (more details), 2.2 Å

PDB Description: the structure of a complex between the nc10 antibody and influenza virus neuraminidase and comparison with the overlapping binding site of the nc41 antibody
PDB Compounds: (H:) fab nc10

SCOPe Domain Sequences for d1nmbh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nmbh1 b.1.1.1 (H:6-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qpgaelvkpgasvrmsckasgytftnynmywvkqspgqglewigifypgngdtsynqkfk
dkatltadkssntaymqlssltsedsavyycarsggsyrydggfdywgqgttltvss

SCOPe Domain Coordinates for d1nmbh1:

Click to download the PDB-style file with coordinates for d1nmbh1.
(The format of our PDB-style files is described here.)

Timeline for d1nmbh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nmbh2