SCOP 1.73: Domain d1nmbl_: 1nmb L:

Lineage for d1nmbl_ (1nmb L:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (181 PDB entries)

8. Domain d1nmbl_: 1nmb L: [20062]
   Other proteins in same PDB: d1nmbh_, d1nmbn_
   part of Fab NC10; only Fv coordinates are included
   complexed with ca, man, nag; mutant

Details for d1nmbl_

PDB Entry: 1nmb, 2.5 Å

PDB Description: the structure of a complex between the nc10 antibody and influenza virus neuraminidase and comparison with the overlapping binding site of the nc41 antibody

PDB Compounds: (L:) fab nc10

SCOP Domain Sequences for d1nmbl_:

Sequence; same for both SEQRES and ATOM records:

>d1nmbl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
diqmtqttsslsaslgdrvtiscrasqdisnylnwyqqnpdgtvklliyytsnlhsevps
rfsgsgsgtdysltisnleqediatyfcqqdftlpftfgggtkleirra

Timeline for d1nmbl_:

• d1nmbl_ first appeared (with stable ids) in SCOP 1.55
  
• d1nmbl_ appears in SCOP 1.71
  
• d1nmbl_ appears in SCOP 1.75
  
• d1nmbl_ appears in the current release, SCOPe 2.08