SCOPe 2.03: Domain d3sdad2: 3sda D:119-243

Lineage for d3sdad2 (3sda D:119-243)

Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (12 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [224855] (237 PDB entries)
Domain d3sdad2: 3sda D:119-243 [200619]
Other proteins in same PDB: d3sdaa1, d3sdab_, d3sdac1, d3sdad1
automated match to d1ktke2
complexed with gcy, gol, nag

Details for d3sdad2

PDB Entry: 3sda (more details), 2.8 Å

PDB Description: crystal structure of autoreactive-valpha14-vbeta6 nkt tcr in complex with cd1d-beta-galactosylceramide

PDB Compounds: (D:) NKT TCR autoreactive-Vbeta6 chain

SCOPe Domain Sequences for d3sdad2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sdad2 b.1.1.2 (D:119-243) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeaw

SCOPe Domain Coordinates for d3sdad2:

Click to download the PDB-style file with coordinates for d3sdad2.
(The format of our PDB-style files is described here.)

Timeline for d3sdad2: