Lineage for d3sdad1 (3sda D:1-118)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1296776Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries)
  8. 1297201Domain d3sdad1: 3sda D:1-118 [200618]
    Other proteins in same PDB: d3sdaa1, d3sdaa2, d3sdab_, d3sdac2, d3sdad2
    automated match to d1ktke1
    complexed with gcy, gol, nag

Details for d3sdad1

PDB Entry: 3sda (more details), 2.8 Å

PDB Description: crystal structure of autoreactive-valpha14-vbeta6 nkt tcr in complex with cd1d-beta-galactosylceramide
PDB Compounds: (D:) NKT TCR autoreactive-Vbeta6 chain

SCOPe Domain Sequences for d3sdad1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sdad1 b.1.1.0 (D:1-118) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ggiitqtpkfligqegqkltlkcqqnfnhdtmywyrqdsgkglrliyysygagstekgdl
segydasrekkssfsltvtsaqknemavflcasgslldvrevffgkgtrltvve

SCOPe Domain Coordinates for d3sdad1:

Click to download the PDB-style file with coordinates for d3sdad1.
(The format of our PDB-style files is described here.)

Timeline for d3sdad1: