SCOPe 2.06: Domain d3sd9a_: 3sd9 A:

Lineage for d3sd9a_ (3sd9 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein automated matches [190079] (9 species)
   not a true protein

7. Species Serratia fonticola [TaxId:47917] [196325] (3 PDB entries)

8. Domain d3sd9a_: 3sd9 A: [200613]
   automated match to d3sd9b_
   complexed with zn

Details for d3sd9a_

PDB Entry: 3sd9, 1.83 Å

PDB Description: Crystal structure of serratia fonticola SFH-I: Source of the nucleophile in the catalytic mechanism of mono-zinc metallo-beta-lactamases

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d3sd9a_:

Sequence; same for both SEQRES and ATOM records:

>d3sd9a_ d.157.1.1 (A:) automated matches {Serratia fonticola [TaxId: 47917]}
knltlthfkgplyivedkeyvqensmvyigtdgitiigatwtpetaetlykeirkvsplp
inevintnyhtdraggnaywktlgakivatqmtydlqksqwgsivnftrqgnnkypnlek
slpdtvfpgdfnlqngsiramylgeahtkdgifvyfpaervlygncilkenlgnmsfanr
teypktleklkglieqgelkvdsiiaghdtpihdvglidhyltllekapk

Timeline for d3sd9a_:

• d3sd9a_ first appeared in SCOPe 2.03
  
• d3sd9a_ appears in SCOPe 2.05
  
• d3sd9a_ appears in SCOPe 2.07
  
• d3sd9a_ appears in the current release, SCOPe 2.08