Lineage for d3sd9a_ (3sd9 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1440053Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1440054Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1440055Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 1440173Protein automated matches [190079] (7 species)
    not a true protein
  7. 1440213Species Serratia fonticola [TaxId:47917] [196325] (2 PDB entries)
  8. 1440216Domain d3sd9a_: 3sd9 A: [200613]
    automated match to d3sd9b_
    complexed with zn

Details for d3sd9a_

PDB Entry: 3sd9 (more details), 1.83 Å

PDB Description: Crystal structure of serratia fonticola SFH-I: Source of the nucleophile in the catalytic mechanism of mono-zinc metallo-beta-lactamases
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d3sd9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sd9a_ d.157.1.1 (A:) automated matches {Serratia fonticola [TaxId: 47917]}
knltlthfkgplyivedkeyvqensmvyigtdgitiigatwtpetaetlykeirkvsplp
inevintnyhtdraggnaywktlgakivatqmtydlqksqwgsivnftrqgnnkypnlek
slpdtvfpgdfnlqngsiramylgeahtkdgifvyfpaervlygncilkenlgnmsfanr
teypktleklkglieqgelkvdsiiaghdtpihdvglidhyltllekapk

SCOPe Domain Coordinates for d3sd9a_:

Click to download the PDB-style file with coordinates for d3sd9a_.
(The format of our PDB-style files is described here.)

Timeline for d3sd9a_: