![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
![]() | Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) ![]() |
![]() | Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) |
![]() | Protein automated matches [190079] (7 species) not a true protein |
![]() | Species Serratia fonticola [TaxId:47917] [196325] (2 PDB entries) |
![]() | Domain d3sd9a_: 3sd9 A: [200613] automated match to d3sd9b_ complexed with zn |
PDB Entry: 3sd9 (more details), 1.83 Å
SCOPe Domain Sequences for d3sd9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sd9a_ d.157.1.1 (A:) automated matches {Serratia fonticola [TaxId: 47917]} knltlthfkgplyivedkeyvqensmvyigtdgitiigatwtpetaetlykeirkvsplp inevintnyhtdraggnaywktlgakivatqmtydlqksqwgsivnftrqgnnkypnlek slpdtvfpgdfnlqngsiramylgeahtkdgifvyfpaervlygncilkenlgnmsfanr teypktleklkglieqgelkvdsiiaghdtpihdvglidhyltllekapk
Timeline for d3sd9a_: