SCOPe 2.03: Domain d3sd0a_: 3sd0 A:

Lineage for d3sd0a_ (3sd0 A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Glycogen synthase kinase-3 beta (Gsk3b) [69823] (1 species)
   CMGC group; GSK3 subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [69824] (30 PDB entries)
   Uniprot P49841 35-383 ! Uniprot P49841 35-384

8. Domain d3sd0a_: 3sd0 A: [200612]
   automated match to d3sd0b_
   complexed with epe, tsk; mutant

Details for d3sd0a_

PDB Entry: 3sd0, 2.7 Å

PDB Description: Identification of a Glycogen Synthase Kinase-3b Inhibitor that Attenuates Hyperactivity in CLOCK Mutant Mice

PDB Compounds: (A:) Glycogen synthase kinase-3 beta

SCOPe Domain Sequences for d3sd0a_:

Sequence; same for both SEQRES and ATOM records:

>d3sd0a_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]}
skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
nrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlp
viyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnv
syicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlg
tptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltplea
cahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphari

Timeline for d3sd0a_:

• d3sd0a_ is new in SCOPe 2.03-stable
  
• d3sd0a_ appears in SCOPe 2.04
  
• d3sd0a_ appears in the current release, SCOPe 2.08