![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Glycogen synthase kinase-3 beta (Gsk3b) [69823] (2 species) CMGC group; GSK3 subfamily; serine/threonine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [69824] (57 PDB entries) Uniprot P49841 35-383 ! Uniprot P49841 35-384 |
![]() | Domain d3sd0a_: 3sd0 A: [200612] automated match to d3sd0b_ complexed with epe, tsk; mutant |
PDB Entry: 3sd0 (more details), 2.7 Å
SCOPe Domain Sequences for d3sd0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sd0a_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk nrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlp viyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnv syicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlg tptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltplea cahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphari
Timeline for d3sd0a_: