Lineage for d3scmd2 (3scm D:119-243)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2363630Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)
  8. 2364192Domain d3scmd2: 3scm D:119-243 [200611]
    Other proteins in same PDB: d3scma1, d3scma2, d3scma3, d3scmb_, d3scmc1, d3scmd1
    automated match to d1ktke2
    complexed with lgn, nag

Details for d3scmd2

PDB Entry: 3scm (more details), 2.5 Å

PDB Description: crystal structure of autoreactive-valpha14-vbeta6 nkt tcr in complex with cd1d-isoglobotrihexosylceramide
PDB Compounds: (D:) NKT TCR autoreactive-Vbeta6 chain

SCOPe Domain Sequences for d3scmd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3scmd2 b.1.1.2 (D:119-243) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeaw

SCOPe Domain Coordinates for d3scmd2:

Click to download the PDB-style file with coordinates for d3scmd2.
(The format of our PDB-style files is described here.)

Timeline for d3scmd2: