Lineage for d3scmd1 (3scm D:1-118)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760337Domain d3scmd1: 3scm D:1-118 [200610]
    Other proteins in same PDB: d3scma1, d3scma2, d3scma3, d3scmb_, d3scmc2, d3scmd2
    automated match to d1ktke1
    complexed with lgn, nag

Details for d3scmd1

PDB Entry: 3scm (more details), 2.5 Å

PDB Description: crystal structure of autoreactive-valpha14-vbeta6 nkt tcr in complex with cd1d-isoglobotrihexosylceramide
PDB Compounds: (D:) NKT TCR autoreactive-Vbeta6 chain

SCOPe Domain Sequences for d3scmd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3scmd1 b.1.1.0 (D:1-118) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ggiitqtpkfligqegqkltlkcqqnfnhdtmywyrqdsgkglrliyysygagstekgdl
segydasrekkssfsltvtsaqknemavflcasgslldvrevffgkgtrltvve

SCOPe Domain Coordinates for d3scmd1:

Click to download the PDB-style file with coordinates for d3scmd1.
(The format of our PDB-style files is described here.)

Timeline for d3scmd1: