SCOPe 2.07: Domain d1a14h1: 1a14 H:9-111

Lineage for d1a14h1 (1a14 H:9-111)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (184 PDB entries)
   Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor

8. Domain d1a14h1: 1a14 H:9-111 [20061]
   Other proteins in same PDB: d1a14h2, d1a14l_, d1a14n_
   part of Fab NC10; only Fv coordinates are included
   complexed with ca, man, nag, ndg

Details for d1a14h1

PDB Entry: 1a14, 2.5 Å

PDB Description: complex between nc10 anti-influenza virus neuraminidase single chain antibody with a 5 residue linker and influenza virus neuraminidase

PDB Compounds: (H:) nc10 fv (heavy chain)

SCOPe Domain Sequences for d1a14h1:

Sequence; same for both SEQRES and ATOM records:

>d1a14h1 b.1.1.1 (H:9-111) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
aelvkpgasvrmsckasgytftnynmywvkqspgqglewigifypgngdtsynqkfkdka
tltadkssntaymqlssltsedsavyycarsggsyrydggfdywgqgttvtv

Timeline for d1a14h1:

• d1a14h1 first appeared (with stable ids) in SCOP 1.55, called d1a14h_
  
• d1a14h1 was called d1a14h_ in SCOPe 2.06
  
• d1a14h1 appears in the current release, SCOPe 2.08