SCOPe 2.05: Domain d1a14h_: 1a14 H:

Lineage for d1a14h_ (1a14 H:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (178 PDB entries)
   Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor

8. Domain d1a14h_: 1a14 H: [20061]
   Other proteins in same PDB: d1a14l_, d1a14n_
   part of Fab NC10; only Fv coordinates are included
   complexed with ca, man, nag, ndg

Details for d1a14h_

PDB Entry: 1a14, 2.5 Å

PDB Description: complex between nc10 anti-influenza virus neuraminidase single chain antibody with a 5 residue linker and influenza virus neuraminidase

PDB Compounds: (H:) nc10 fv (heavy chain)

SCOPe Domain Sequences for d1a14h_:

Sequence; same for both SEQRES and ATOM records:

>d1a14h_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qvqlqqsgaelvkpgasvrmsckasgytftnynmywvkqspgqglewigifypgngdtsy
nqkfkdkatltadkssntaymqlssltsedsavyycarsggsyrydggfdywgqgttvtv

Timeline for d1a14h_:

• d1a14h_ first appeared (with stable ids) in SCOP 1.55
  
• d1a14h_ appears in SCOPe 2.04
  
• d1a14h_ appears in SCOPe 2.06
  
• d1a14h_ appears in the current release, SCOPe 2.08, called d1a14h1