SCOP 1.57: Domain d1a14h_: 1a14 H:

Lineage for d1a14h_ (1a14 H:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Fab NC10 (mouse), kappa L chain [48804] (4 PDB entries)

8. Domain d1a14h_: 1a14 H: [20061]
   Other proteins in same PDB: d1a14n_

Details for d1a14h_

PDB Entry: 1a14, 2.5 Å

PDB Description: complex between nc10 anti-influenza virus neuraminidase single chain antibody with a 5 residue linker and influenza virus neuraminidase

SCOP Domain Sequences for d1a14h_:

Sequence; same for both SEQRES and ATOM records:

>d1a14h_ b.1.1.1 (H:) Immunoglobulin (variable domains of L and H chains) {Fab NC10 (mouse), kappa L chain}
qvqlqqsgaelvkpgasvrmsckasgytftnynmywvkqspgqglewigifypgngdtsy
nqkfkdkatltadkssntaymqlssltsedsavyycarsggsyrydggfdywgqgttvtv

Timeline for d1a14h_:

• d1a14h_ first appeared (with stable ids) in SCOP 1.55
  
• d1a14h_ appears in SCOP 1.59
  
• d1a14h_ appears in the current release, SCOPe 2.08, called d1a14h1