SCOPe 2.04: Domain d3scma2: 3scm A:186-295

Lineage for d3scma2 (3scm A:186-295)

Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein CD1, alpha-3 domain [88615] (5 species)
Species Mouse (Mus musculus) [TaxId:10090] [88616] (9 PDB entries)
Domain d3scma2: 3scm A:186-295 [200607]
Other proteins in same PDB: d3scma1, d3scmb_, d3scmc1, d3scmc2, d3scmd1, d3scmd2
automated match to d1gzqa1
complexed with lgn, nag

Details for d3scma2

PDB Entry: 3scm (more details), 2.5 Å

PDB Description: crystal structure of autoreactive-valpha14-vbeta6 nkt tcr in complex with cd1d-isoglobotrihexosylceramide

PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d3scma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3scma2 b.1.1.2 (A:186-295) CD1, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilywgslhhildaqkmvwnh

SCOPe Domain Coordinates for d3scma2:

Click to download the PDB-style file with coordinates for d3scma2.
(The format of our PDB-style files is described here.)

Timeline for d3scma2: