Lineage for d3sala_ (3sal A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807606Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2807607Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2808129Family b.68.1.0: automated matches [191452] (1 protein)
    not a true family
  6. 2808130Protein automated matches [190692] (20 species)
    not a true protein
  7. 2808185Species Influenza A virus [TaxId:385582] [189809] (3 PDB entries)
  8. 2808186Domain d3sala_: 3sal A: [200601]
    automated match to d3ti8a_
    complexed with ca, gol

Details for d3sala_

PDB Entry: 3sal (more details), 1.5 Å

PDB Description: crystal structure of influenza a virus neuraminidase n5
PDB Compounds: (A:) Neuraminidase

SCOPe Domain Sequences for d3sala_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sala_ b.68.1.0 (A:) automated matches {Influenza A virus [TaxId: 385582]}
peflnnteplcnvsgfaivskdngirigsrghvfvirepfvacgptecrtffltqgalln
dkhsnntvkdrspyralmsvplgsspnayqakfesvawsatachdgkkwlavgisgaddd
ayavihyggmptdvvrswrkqilrtqesscvcmngncywvmtdgpansqasykifksheg
mvtnerevsfqgghieecscypnlgkvecvcrdnwngmnrpilifdedldyevgylcagi
ptdtprvqdssftgsctnavggsgtnnygvkgfgfrqgnsvwagrtvsissrsgfeilli
edgwirtsktivkkvevlnnknwsgysgaftipitmtskqclvpcfwlemirgkpeerts
iwtsssstvfcgvssevpgwswddgailpfdidk

SCOPe Domain Coordinates for d3sala_:

Click to download the PDB-style file with coordinates for d3sala_.
(The format of our PDB-style files is described here.)

Timeline for d3sala_: