Lineage for d1a14l_ (1a14 L:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7798Species Fab NC10 (mouse), kappa L chain [48804] (4 PDB entries)
  8. 7800Domain d1a14l_: 1a14 L: [20060]
    Other proteins in same PDB: d1a14n_

Details for d1a14l_

PDB Entry: 1a14 (more details), 2.5 Å

PDB Description: complex between nc10 anti-influenza virus neuraminidase single chain antibody with a 5 residue linker and influenza virus neuraminidase

SCOP Domain Sequences for d1a14l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a14l_ b.1.1.1 (L:) Immunoglobulin (variable domains of L and H chains) {Fab NC10 (mouse), kappa L chain}
dieltqttsslsaslgdrvtiscrasqdisnylnwyqqnpdgtvklliyytsnlhsevps
rfsgsgsgtdysltisnleqediatyfcqqdftlpftfgggtaa

SCOP Domain Coordinates for d1a14l_:

Click to download the PDB-style file with coordinates for d1a14l_.
(The format of our PDB-style files is described here.)

Timeline for d1a14l_: