Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.4: ITPase-like [52972] (4 families) formerly Maf/Ham1; elaborated with additional structures inserted in the common fold |
Family c.51.4.1: ITPase (Ham1) [52973] (4 proteins) Pfam PF01725 |
Protein Putative inosine/xanthosine triphosphate pyrophosphatase TM0159 [117615] (1 species) |
Species Thermotoga maritima [TaxId:2336] [117616] (2 PDB entries) Uniprot Q9WY06 |
Domain d3s86d_: 3s86 D: [200595] automated match to d1vp2a_ complexed with imp, so4 |
PDB Entry: 3s86 (more details), 2.15 Å
SCOPe Domain Sequences for d3s86d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s86d_ c.51.4.1 (D:) Putative inosine/xanthosine triphosphate pyrophosphatase TM0159 {Thermotoga maritima [TaxId: 2336]} kltvylattnphkveeikmiapewmeilpspekievvedgetflensvkkavvygkklkh pvmaddsglviyslggfpgvmsarfmeehsykekmrtilkmlegkdrraafvcsatffdp ventlisvedrvegrianeirgtggfgydpffipdgydktfgeiphlkekishrskafrk lfsvlekil
Timeline for d3s86d_: