Lineage for d3s86d_ (3s86 D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1856157Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 1856374Superfamily c.51.4: ITPase-like [52972] (4 families) (S)
    formerly Maf/Ham1; elaborated with additional structures inserted in the common fold
  5. 1856375Family c.51.4.1: ITPase (Ham1) [52973] (4 proteins)
    Pfam PF01725
  6. 1856382Protein Putative inosine/xanthosine triphosphate pyrophosphatase TM0159 [117615] (1 species)
  7. 1856383Species Thermotoga maritima [TaxId:2336] [117616] (2 PDB entries)
    Uniprot Q9WY06
  8. 1856389Domain d3s86d_: 3s86 D: [200595]
    automated match to d1vp2a_
    complexed with imp, so4

Details for d3s86d_

PDB Entry: 3s86 (more details), 2.15 Å

PDB Description: Crystal Structure of TM0159 with bound IMP
PDB Compounds: (D:) Nucleoside-triphosphatase

SCOPe Domain Sequences for d3s86d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s86d_ c.51.4.1 (D:) Putative inosine/xanthosine triphosphate pyrophosphatase TM0159 {Thermotoga maritima [TaxId: 2336]}
kltvylattnphkveeikmiapewmeilpspekievvedgetflensvkkavvygkklkh
pvmaddsglviyslggfpgvmsarfmeehsykekmrtilkmlegkdrraafvcsatffdp
ventlisvedrvegrianeirgtggfgydpffipdgydktfgeiphlkekishrskafrk
lfsvlekil

SCOPe Domain Coordinates for d3s86d_:

Click to download the PDB-style file with coordinates for d3s86d_.
(The format of our PDB-style files is described here.)

Timeline for d3s86d_: