SCOPe 2.05: Domain d3s86b_: 3s86 B:

Lineage for d3s86b_ (3s86 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.4: ITPase-like [52972] (4 families)
   formerly Maf/Ham1; elaborated with additional structures inserted in the common fold

5. Family c.51.4.1: ITPase (Ham1) [52973] (4 proteins)
   Pfam PF01725

6. Protein Putative inosine/xanthosine triphosphate pyrophosphatase TM0159 [117615] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [117616] (2 PDB entries)
   Uniprot Q9WY06

8. Domain d3s86b_: 3s86 B: [200594]
   automated match to d1vp2a_
   complexed with imp, so4

Details for d3s86b_

PDB Entry: 3s86, 2.15 Å

PDB Description: Crystal Structure of TM0159 with bound IMP

PDB Compounds: (B:) Nucleoside-triphosphatase

SCOPe Domain Sequences for d3s86b_:

Sequence; same for both SEQRES and ATOM records:

>d3s86b_ c.51.4.1 (B:) Putative inosine/xanthosine triphosphate pyrophosphatase TM0159 {Thermotoga maritima [TaxId: 2336]}
kltvylattnphkveeikmiapewmeilpspekievvedgetflensvkkavvygkklkh
pvmaddsglviyslggfpgvmsarfmeehsykekmrtilkmlegkdrraafvcsatffdp
ventlisvedrvegrianeirgtggfgydpffipdgydktfgeiphlkekishrskafrk
lfsvlekil

Timeline for d3s86b_:

• d3s86b_ first appeared in SCOPe 2.03
  
• d3s86b_ appears in SCOPe 2.04
  
• d3s86b_ appears in SCOPe 2.06
  
• d3s86b_ appears in the current release, SCOPe 2.08