SCOPe 2.07: Domain d3s6ng_: 3s6n G:

Lineage for d3s6ng_ (3s6n G:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families)

5. Family b.38.1.0: automated matches [191538] (1 protein)
   not a true family

6. Protein automated matches [190914] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [196227] (11 PDB entries)

8. Domain d3s6ng_: 3s6n G: [200591]
   Other proteins in same PDB: d3s6na_, d3s6nb_
   automated match to d3swne_
   protein/RNA complex

Details for d3s6ng_

PDB Entry: 3s6n, 2.5 Å

PDB Description: crystal structure of the gemin2-binding domain of smn, gemin2 in complex with smd1/d2/f/e/g from human

PDB Compounds: (G:) Small nuclear ribonucleoprotein G

SCOPe Domain Sequences for d3s6ng_:

Sequence, based on SEQRES records:

>d3s6ng_ b.38.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dkklslklnggrhvqgilrgfdpfmnlvidecvematsgqqnnigmvvirgnsiimlea

Sequence, based on observed residues (ATOM records):

>d3s6ng_ b.38.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dkklslklnggrhvqgilrgfdpfmnlvidecvematsnigmvvirgnsiimlea

Timeline for d3s6ng_:

• d3s6ng_ first appeared in SCOPe 2.03
  
• d3s6ng_ appears in SCOPe 2.06
  
• d3s6ng_ does not appear in SCOPe 2.08