Lineage for d3s6jc_ (3s6j C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920270Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2920271Protein automated matches [190447] (55 species)
    not a true protein
  7. 2920621Species Pseudomonas syringae [TaxId:323] [189694] (1 PDB entry)
  8. 2920624Domain d3s6jc_: 3s6j C: [200588]
    automated match to d3s6jd_
    complexed with ca

Details for d3s6jc_

PDB Entry: 3s6j (more details), 2.2 Å

PDB Description: the crystal structure of a hydrolase from pseudomonas syringae
PDB Compounds: (C:) Hydrolase, haloacid dehalogenase-like family

SCOPe Domain Sequences for d3s6jc_:

Sequence, based on SEQRES records: (download)

>d3s6jc_ c.108.1.0 (C:) automated matches {Pseudomonas syringae [TaxId: 323]}
qtsfifdldgtltdsvyqnvaawkealdaeniplamwrihrkigmsgglmlkslsretgm
sitdeqaerlsekhaqayerlqhqiialpgavelletldkenlkwciatsggidtatinl
kalkldinkinivtrddvsygkpdpdlflaaakkigapideclvigdaiwdmlaarrcka
tgvgllsggydigeleragalrvyedpldllnhldeias

Sequence, based on observed residues (ATOM records): (download)

>d3s6jc_ c.108.1.0 (C:) automated matches {Pseudomonas syringae [TaxId: 323]}
qtsfifdldgtltdsvyqnvaawkealdaeniplamwrihrkigmsgglmtgmsitdeqa
erlsekhaqayerlqhqiialpgavelletldkenlkwciatsggidtatinlkalkldi
nkinivtrddvsygkpdpdlflaaakkigapideclvigdaiwdmlaarrckatgvglls
ggydigeleragalrvyedpldllnhldeias

SCOPe Domain Coordinates for d3s6jc_:

Click to download the PDB-style file with coordinates for d3s6jc_.
(The format of our PDB-style files is described here.)

Timeline for d3s6jc_: