SCOPe 2.07: Domain d3s6jb_: 3s6j B:

Lineage for d3s6jb_ (3s6j B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (55 species)
   not a true protein

7. Species Pseudomonas syringae [TaxId:323] [189694] (1 PDB entry)

8. Domain d3s6jb_: 3s6j B: [200587]
   automated match to d3s6jd_
   complexed with ca

Details for d3s6jb_

PDB Entry: 3s6j, 2.2 Å

PDB Description: the crystal structure of a hydrolase from pseudomonas syringae

PDB Compounds: (B:) Hydrolase, haloacid dehalogenase-like family

SCOPe Domain Sequences for d3s6jb_:

Sequence, based on SEQRES records:

>d3s6jb_ c.108.1.0 (B:) automated matches {Pseudomonas syringae [TaxId: 323]}
qtsfifdldgtltdsvyqnvaawkealdaeniplamwrihrkigmsgglmlkslsretgm
sitdeqaerlsekhaqayerlqhqiialpgavelletldkenlkwciatsggidtatinl
kalkldinkinivtrddvsygkpdpdlflaaakkigapideclvigdaiwdmlaarrcka
tgvgllsggydigeleragalrvyedpldllnhldeias

Sequence, based on observed residues (ATOM records):

>d3s6jb_ c.108.1.0 (B:) automated matches {Pseudomonas syringae [TaxId: 323]}
qtsfifdldgtltdsvyqnvaawkealdaeniplamwrihrkigmsgglmlitdeqaerl
sekhaqayerlqhqiialpgavelletldkenlkwciatsggidtatinlkalkldinki
nivtrddvsygkpdpdlflaaakkigapideclvigdaiwdmlaarrckatgvgllsggy
digeleragalrvyedpldllnhldeias

Timeline for d3s6jb_:

• d3s6jb_ first appeared in SCOPe 2.03
  
• d3s6jb_ appears in SCOPe 2.06
  
• d3s6jb_ appears in the current release, SCOPe 2.08