![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, alpha-chain [46486] (23 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [46487] (213 PDB entries) Uniprot P69905 P01922 P01934 P01935 |
![]() | Domain d3s65c_: 3s65 C: [200585] Other proteins in same PDB: d3s65b_, d3s65d_ automated match to d1irda_ complexed with cmo, hem |
PDB Entry: 3s65 (more details), 1.8 Å
SCOPe Domain Sequences for d3s65c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s65c_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]} vlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa vhasldkflasvstvltskyr
Timeline for d3s65c_: