SCOPe 2.08: Domain d3rzcd2: 3rzc D:113-240

Lineage for d3rzcd2 (3rzc D:113-240)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d3rzcd2: 3rzc D:113-240 [200574]
   Other proteins in same PDB: d3rzca1, d3rzca2, d3rzcb_, d3rzcc2, d3rzcd1
   automated match to d1lp9f2
   complexed with lgn

Details for d3rzcd2

PDB Entry: 3rzc, 2.8 Å

PDB Description: structure of the self-antigen igb3 bound to mouse cd1d and in complex with the inkt tcr

PDB Compounds: (D:) Vbeta8.2

SCOPe Domain Sequences for d3rzcd2:

Sequence; same for both SEQRES and ATOM records:

>d3rzcd2 b.1.1.0 (D:113-240) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlrnvtppkvslfepskaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

Timeline for d3rzcd2:

• d3rzcd2 first appeared in SCOPe 2.03
  
• d3rzcd2 appears in SCOPe 2.07