SCOPe 2.08: Domain d3rzcd1: 3rzc D:2-112

Lineage for d3rzcd1 (3rzc D:2-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (28 PDB entries)

8. Domain d3rzcd1: 3rzc D:2-112 [200573]
   Other proteins in same PDB: d3rzca1, d3rzca2, d3rzcb_, d3rzcc1, d3rzcc2, d3rzcd2
   automated match to d1lp9f1
   complexed with lgn

Details for d3rzcd1

PDB Entry: 3rzc, 2.8 Å

PDB Description: structure of the self-antigen igb3 bound to mouse cd1d and in complex with the inkt tcr

PDB Compounds: (D:) Vbeta8.2

SCOPe Domain Sequences for d3rzcd1:

Sequence; same for both SEQRES and ATOM records:

>d3rzcd1 b.1.1.1 (D:2-112) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
aavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdip
dgykasrpsqenfslilelatpsqtsvyfcasgdegytqyfgpgtrllvle

Timeline for d3rzcd1:

• d3rzcd1 first appeared in SCOPe 2.03
  
• d3rzcd1 appears in SCOPe 2.07