Lineage for d3rzcd1 (3rzc D:2-112)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2741896Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 2742041Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (28 PDB entries)
  8. 2742053Domain d3rzcd1: 3rzc D:2-112 [200573]
    Other proteins in same PDB: d3rzca1, d3rzca2, d3rzcb_, d3rzcc1, d3rzcc2, d3rzcd2
    automated match to d1lp9f1
    complexed with lgn

Details for d3rzcd1

PDB Entry: 3rzc (more details), 2.8 Å

PDB Description: structure of the self-antigen igb3 bound to mouse cd1d and in complex with the inkt tcr
PDB Compounds: (D:) Vbeta8.2

SCOPe Domain Sequences for d3rzcd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rzcd1 b.1.1.1 (D:2-112) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
aavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdip
dgykasrpsqenfslilelatpsqtsvyfcasgdegytqyfgpgtrllvle

SCOPe Domain Coordinates for d3rzcd1:

Click to download the PDB-style file with coordinates for d3rzcd1.
(The format of our PDB-style files is described here.)

Timeline for d3rzcd1: