Lineage for d3rzcc2 (3rzc C:118-206)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361044Protein T-cell antigen receptor [49125] (7 species)
  7. 2361145Species Mouse (Mus musculus) [TaxId:10090] [226194] (2 PDB entries)
  8. 2361147Domain d3rzcc2: 3rzc C:118-206 [200572]
    Other proteins in same PDB: d3rzca1, d3rzca2, d3rzcb_, d3rzcc1, d3rzcd1, d3rzcd2
    automated match to d1qrnd2
    complexed with lgn

Details for d3rzcc2

PDB Entry: 3rzc (more details), 2.8 Å

PDB Description: structure of the self-antigen igb3 bound to mouse cd1d and in complex with the inkt tcr
PDB Compounds: (C:) Valpha14

SCOPe Domain Sequences for d3rzcc2:

Sequence, based on SEQRES records: (download)

>d3rzcc2 b.1.1.2 (C:118-206) T-cell antigen receptor {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records): (download)

>d3rzcc2 b.1.1.2 (C:118-206) T-cell antigen receptor {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnkdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d3rzcc2:

Click to download the PDB-style file with coordinates for d3rzcc2.
(The format of our PDB-style files is described here.)

Timeline for d3rzcc2: