Lineage for d3rzca2 (3rzc A:186-279)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752857Domain d3rzca2: 3rzc A:186-279 [200570]
    Other proteins in same PDB: d3rzca1, d3rzcb_, d3rzcc1, d3rzcc2, d3rzcd1, d3rzcd2
    automated match to d1onqa1
    complexed with lgn

Details for d3rzca2

PDB Entry: 3rzc (more details), 2.8 Å

PDB Description: structure of the self-antigen igb3 bound to mouse cd1d and in complex with the inkt tcr
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d3rzca2:

Sequence, based on SEQRES records: (download)

>d3rzca2 b.1.1.2 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

Sequence, based on observed residues (ATOM records): (download)

>d3rzca2 b.1.1.2 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvprqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylqatl
dveageeaglacrvkhsslggqdiilyw

SCOPe Domain Coordinates for d3rzca2:

Click to download the PDB-style file with coordinates for d3rzca2.
(The format of our PDB-style files is described here.)

Timeline for d3rzca2: