| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
| Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
| Protein automated matches [227071] (2 species) not a true protein |
| Species Sheep (Ovis aries) [TaxId:9940] [226224] (9 PDB entries) |
| Domain d3ryid2: 3ryi D:246-441 [200568] Other proteins in same PDB: d3ryia1, d3ryib1, d3ryic1, d3ryid1, d3ryie_ automated match to d1z2bb2 complexed with gdp, gtp, mg, so4 |
PDB Entry: 3ryi (more details), 2.4 Å
SCOPe Domain Sequences for d3ryid2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ryid2 d.79.2.1 (D:246-441) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvatifrgrmsmkevdeqmlniqnknssyfvewipnnvktavcdipprglkm
sstfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad
Timeline for d3ryid2: