SCOPe 2.07: Domain d3ryhd2: 3ryh D:246-441

Lineage for d3ryhd2 (3ryh D:246-441)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (7 species)
   not a true protein

7. Species Sheep (Ovis aries) [TaxId:9940] [226224] (26 PDB entries)

8. Domain d3ryhd2: 3ryh D:246-441 [200560]
   Other proteins in same PDB: d3ryha1, d3ryhb1, d3ryhc1, d3ryhd1, d3ryhe1, d3ryhe2
   automated match to d1z2bb2
   complexed with g2p, gtp, mg, so4

Details for d3ryhd2

PDB Entry: 3ryh, 2.8 Å

PDB Description: GMPCPP-Tubulin: RB3 Stathmin-like domain complex

PDB Compounds: (D:) Tubulin beta chain

SCOPe Domain Sequences for d3ryhd2:

Sequence; same for both SEQRES and ATOM records:

>d3ryhd2 d.79.2.1 (D:246-441) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvatifrgrmsmkevdeqmlniqnknssyfvewipnnvktavcdipprglkm
sstfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad

Timeline for d3ryhd2:

• d3ryhd2 first appeared in SCOPe 2.03
  
• d3ryhd2 appears in SCOPe 2.06
  
• d3ryhd2 appears in the current release, SCOPe 2.08