Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein automated matches [227071] (7 species) not a true protein |
Species Sheep (Ovis aries) [TaxId:9940] [226224] (26 PDB entries) |
Domain d3ryhd2: 3ryh D:246-441 [200560] Other proteins in same PDB: d3ryha1, d3ryhb1, d3ryhc1, d3ryhd1, d3ryhe1, d3ryhe2 automated match to d1z2bb2 complexed with g2p, gtp, mg, so4 |
PDB Entry: 3ryh (more details), 2.8 Å
SCOPe Domain Sequences for d3ryhd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ryhd2 d.79.2.1 (D:246-441) automated matches {Sheep (Ovis aries) [TaxId: 9940]} gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac dprhgryltvatifrgrmsmkevdeqmlniqnknssyfvewipnnvktavcdipprglkm sstfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq qyqdatad
Timeline for d3ryhd2: