Lineage for d3ryhb2 (3ryh B:246-442)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2959091Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2959092Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2959213Protein automated matches [227071] (7 species)
    not a true protein
  7. 2959964Species Sheep (Ovis aries) [TaxId:9940] [226224] (15 PDB entries)
  8. 2959990Domain d3ryhb2: 3ryh B:246-442 [200556]
    Other proteins in same PDB: d3ryha1, d3ryhb1, d3ryhc1, d3ryhd1, d3ryhe1, d3ryhe2
    automated match to d1z2bb2
    complexed with g2p, gtp, mg, so4

Details for d3ryhb2

PDB Entry: 3ryh (more details), 2.8 Å

PDB Description: GMPCPP-Tubulin: RB3 Stathmin-like domain complex
PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d3ryhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ryhb2 d.79.2.1 (B:246-442) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvatifrgrmsmkevdeqmlniqnknssyfvewipnnvktavcdipprglkm
sstfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatade

SCOPe Domain Coordinates for d3ryhb2:

Click to download the PDB-style file with coordinates for d3ryhb2.
(The format of our PDB-style files is described here.)

Timeline for d3ryhb2: