| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
| Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
| Protein automated matches [226837] (6 species) not a true protein |
| Species Sheep (Ovis aries) [TaxId:9940] [224884] (11 PDB entries) |
| Domain d3ryfd1: 3ryf D:1-245 [200551] Other proteins in same PDB: d3ryfa2, d3ryfb2, d3ryfc2, d3ryfd2, d3ryfe_ automated match to d1z2bb1 complexed with gtp, mg, so4 |
PDB Entry: 3ryf (more details), 2.52 Å
SCOPe Domain Sequences for d3ryfd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ryfd1 c.32.1.1 (D:1-245) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetysidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp
Timeline for d3ryfd1: