Lineage for d3ryfd1 (3ryf D:1-245)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1843633Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1843634Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 1843635Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 1843745Protein automated matches [226837] (6 species)
    not a true protein
  7. 1843814Species Sheep (Ovis aries) [TaxId:9940] [224884] (11 PDB entries)
  8. 1843832Domain d3ryfd1: 3ryf D:1-245 [200551]
    Other proteins in same PDB: d3ryfa2, d3ryfb2, d3ryfc2, d3ryfd2, d3ryfe_
    automated match to d1z2bb1
    complexed with gtp, mg, so4

Details for d3ryfd1

PDB Entry: 3ryf (more details), 2.52 Å

PDB Description: GTP-Tubulin: RB3 Stathmin-like domain complex
PDB Compounds: (D:) Tubulin beta chain

SCOPe Domain Sequences for d3ryfd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ryfd1 c.32.1.1 (D:1-245) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetysidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

SCOPe Domain Coordinates for d3ryfd1:

Click to download the PDB-style file with coordinates for d3ryfd1.
(The format of our PDB-style files is described here.)

Timeline for d3ryfd1: