SCOPe 2.05: Domain d3ryfc2: 3ryf C:246-439

Lineage for d3ryfc2 (3ryf C:246-439)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (5 species)
   not a true protein

7. Species Sheep (Ovis aries) [TaxId:9940] [226224] (11 PDB entries)

8. Domain d3ryfc2: 3ryf C:246-439 [200550]
   Other proteins in same PDB: d3ryfa1, d3ryfb1, d3ryfc1, d3ryfd1, d3ryfe_
   automated match to d1z2ba2
   complexed with gtp, mg, so4

Details for d3ryfc2

PDB Entry: 3ryf, 2.52 Å

PDB Description: GTP-Tubulin: RB3 Stathmin-like domain complex

PDB Compounds: (C:) Tubulin alpha chain

SCOPe Domain Sequences for d3ryfc2:

Sequence; same for both SEQRES and ATOM records:

>d3ryfc2 d.79.2.1 (C:246-439) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvds

Timeline for d3ryfc2:

• d3ryfc2 first appeared in SCOPe 2.03
  
• d3ryfc2 appears in SCOPe 2.04
  
• d3ryfc2 appears in SCOPe 2.06
  
• d3ryfc2 appears in the current release, SCOPe 2.08