Lineage for d1mlcd1 (1mlc D:1-118)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219712Species Fab D44.1 (mouse), kappa L chain [48803] (2 PDB entries)
  8. 219718Domain d1mlcd1: 1mlc D:1-118 [20055]
    Other proteins in same PDB: d1mlca2, d1mlcb2, d1mlcc2, d1mlcd2, d1mlce_, d1mlcf_

Details for d1mlcd1

PDB Entry: 1mlc (more details), 2.1 Å

PDB Description: monoclonal antibody fab d44.1 raised against chicken egg-white lysozyme complexed with lysozyme

SCOP Domain Sequences for d1mlcd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mlcd1 b.1.1.1 (D:1-118) Immunoglobulin (variable domains of L and H chains) {Fab D44.1 (mouse), kappa L chain}
qvqlqesgaevmkpgasvkisckatgytfstywiewvkqrpghglewigeilpgsgstyy
nekfkgkatftadtssntaymqlssltsedsavyycargdgnygywgqgttltvssas

SCOP Domain Coordinates for d1mlcd1:

Click to download the PDB-style file with coordinates for d1mlcd1.
(The format of our PDB-style files is described here.)

Timeline for d1mlcd1: