SCOPe 2.04: Domain d3ryfb1: 3ryf B:1-245

Lineage for d3ryfb1 (3ryf B:1-245)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (3 species)
   not a true protein

7. Species Sheep (Ovis aries) [TaxId:9940] [224884] (9 PDB entries)

8. Domain d3ryfb1: 3ryf B:1-245 [200547]
   Other proteins in same PDB: d3ryfa2, d3ryfb2, d3ryfc2, d3ryfd2, d3ryfe_
   automated match to d1z2bb1
   complexed with gtp, mg, so4

Details for d3ryfb1

PDB Entry: 3ryf, 2.52 Å

PDB Description: GTP-Tubulin: RB3 Stathmin-like domain complex

PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d3ryfb1:

Sequence; same for both SEQRES and ATOM records:

>d3ryfb1 c.32.1.1 (B:1-245) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetysidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

Timeline for d3ryfb1:

• d3ryfb1 first appeared in SCOPe 2.03
  
• d3ryfb1 appears in SCOPe 2.05
  
• d3ryfb1 appears in the current release, SCOPe 2.08