Lineage for d3ryfb1 (3ryf B:1-245)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1361112Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1361113Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 1361114Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 1361222Protein automated matches [226837] (3 species)
    not a true protein
  7. 1361268Species Sheep (Ovis aries) [TaxId:9940] [224884] (7 PDB entries)
  8. 1361282Domain d3ryfb1: 3ryf B:1-245 [200547]
    Other proteins in same PDB: d3ryfa2, d3ryfb2, d3ryfc2, d3ryfd2, d3ryfe_
    automated match to d1z2bb1
    complexed with gtp, mg, so4

Details for d3ryfb1

PDB Entry: 3ryf (more details), 2.52 Å

PDB Description: GTP-Tubulin: RB3 Stathmin-like domain complex
PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d3ryfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ryfb1 c.32.1.1 (B:1-245) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetysidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

SCOPe Domain Coordinates for d3ryfb1:

Click to download the PDB-style file with coordinates for d3ryfb1.
(The format of our PDB-style files is described here.)

Timeline for d3ryfb1: