| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
| Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
| Protein automated matches [227071] (5 species) not a true protein |
| Species Sheep (Ovis aries) [TaxId:9940] [226224] (15 PDB entries) |
| Domain d3rycc2: 3ryc C:246-439 [200542] Other proteins in same PDB: d3ryca1, d3rycb1, d3rycc1, d3rycd1, d3ryce1, d3ryce2 automated match to d1z2ba2 complexed with gdp, gtp, mg, so4 |
PDB Entry: 3ryc (more details), 2.1 Å
SCOPe Domain Sequences for d3rycc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rycc2 d.79.2.1 (C:246-439) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvds
Timeline for d3rycc2: