Lineage for d3rycc2 (3ryc C:246-439)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201108Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2201404Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2201405Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2201524Protein automated matches [227071] (5 species)
    not a true protein
  7. 2201730Species Sheep (Ovis aries) [TaxId:9940] [226224] (15 PDB entries)
  8. 2201737Domain d3rycc2: 3ryc C:246-439 [200542]
    Other proteins in same PDB: d3ryca1, d3rycb1, d3rycc1, d3rycd1, d3ryce1, d3ryce2
    automated match to d1z2ba2
    complexed with gdp, gtp, mg, so4

Details for d3rycc2

PDB Entry: 3ryc (more details), 2.1 Å

PDB Description: Tubulin: RB3 stathmin-like domain complex
PDB Compounds: (C:) Tubulin alpha chain

SCOPe Domain Sequences for d3rycc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rycc2 d.79.2.1 (C:246-439) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvds

SCOPe Domain Coordinates for d3rycc2:

Click to download the PDB-style file with coordinates for d3rycc2.
(The format of our PDB-style files is described here.)

Timeline for d3rycc2: