![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
![]() | Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
![]() | Protein automated matches [227071] (5 species) not a true protein |
![]() | Species Sheep (Ovis aries) [TaxId:9940] [226224] (11 PDB entries) |
![]() | Domain d3rycb2: 3ryc B:246-442 [200540] Other proteins in same PDB: d3ryca1, d3rycb1, d3rycc1, d3rycd1, d3ryce_ automated match to d1z2bb2 complexed with gdp, gtp, mg, so4 |
PDB Entry: 3ryc (more details), 2.1 Å
SCOPe Domain Sequences for d3rycb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rycb2 d.79.2.1 (B:246-442) automated matches {Sheep (Ovis aries) [TaxId: 9940]} gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac dprhgryltvatifrgrmsmkevdeqmlniqnknssyfvewipnnvktavcdipprglkm sstfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq qyqdatade
Timeline for d3rycb2: