SCOPe 2.03: Domain d3rycb2: 3ryc B:246-442

Lineage for d3rycb2 (3ryc B:246-442)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (2 species)
   not a true protein

7. Species Sheep (Ovis aries) [TaxId:9940] [226224] (7 PDB entries)

8. Domain d3rycb2: 3ryc B:246-442 [200540]
   Other proteins in same PDB: d3ryca1, d3rycb1, d3rycc1, d3rycd1, d3ryce_
   automated match to d1z2bb2
   complexed with gdp, gtp, mg, so4

Details for d3rycb2

PDB Entry: 3ryc, 2.1 Å

PDB Description: Tubulin: RB3 stathmin-like domain complex

PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d3rycb2:

Sequence; same for both SEQRES and ATOM records:

>d3rycb2 d.79.2.1 (B:246-442) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvatifrgrmsmkevdeqmlniqnknssyfvewipnnvktavcdipprglkm
sstfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatade

Timeline for d3rycb2:

• d3rycb2 is new in SCOPe 2.03-stable
  
• d3rycb2 appears in SCOPe 2.04
  
• d3rycb2 appears in the current release, SCOPe 2.08