SCOP 1.69: Domain d1mlcc1: 1mlc C:1-108

Lineage for d1mlcc1 (1mlc C:1-108)

Root: SCOP 1.69
Class b: All beta proteins [48724] (144 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (162 PDB entries)
Domain d1mlcc1: 1mlc C:1-108 [20054]
Other proteins in same PDB: d1mlca2, d1mlcb1, d1mlcb2, d1mlcc2, d1mlcd1, d1mlcd2, d1mlce_, d1mlcf_
part of Fab D44.1

Details for d1mlcc1

PDB Entry: 1mlc (more details), 2.1 Å

PDB Description: monoclonal antibody fab d44.1 raised against chicken egg-white lysozyme complexed with lysozyme

SCOP Domain Sequences for d1mlcc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mlcc1 b.1.1.1 (C:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
dieltqspatlsvtpgdsvslscrasqsisnnlhwyqqkshesprllikyvsqsssgips
rfsgsgsgtdftlsinsvetedfgmyfcqqsnswprtfgggtkleikr

SCOP Domain Coordinates for d1mlcc1:

Click to download the PDB-style file with coordinates for d1mlcc1.
(The format of our PDB-style files is described here.)

Timeline for d1mlcc1: