SCOP 1.61: Domain d1mlcc1: 1mlc C:1-108

Lineage for d1mlcc1 (1mlc C:1-108)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Fab D44.1 (mouse), kappa L chain [48803] (2 PDB entries)

8. Domain d1mlcc1: 1mlc C:1-108 [20054]
   Other proteins in same PDB: d1mlca2, d1mlcb2, d1mlcc2, d1mlcd2, d1mlce_, d1mlcf_

Details for d1mlcc1

PDB Entry: 1mlc, 2.1 Å

PDB Description: monoclonal antibody fab d44.1 raised against chicken egg-white lysozyme complexed with lysozyme

SCOP Domain Sequences for d1mlcc1:

Sequence; same for both SEQRES and ATOM records:

>d1mlcc1 b.1.1.1 (C:1-108) Immunoglobulin (variable domains of L and H chains) {Fab D44.1 (mouse), kappa L chain}
dieltqspatlsvtpgdsvslscrasqsisnnlhwyqqkshesprllikyvsqsssgips
rfsgsgsgtdftlsinsvetedfgmyfcqqsnswprtfgggtkleikr

Timeline for d1mlcc1:

• d1mlcc1 first appeared (with stable ids) in SCOP 1.55
  
• d1mlcc1 appears in SCOP 1.59
  
• d1mlcc1 appears in SCOP 1.63
  
• d1mlcc1 appears in the current release, SCOPe 2.08