Lineage for d1mlcc1 (1mlc C:1-108)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52314Species Fab D44.1 (mouse), kappa L chain [48803] (2 PDB entries)
  8. 52319Domain d1mlcc1: 1mlc C:1-108 [20054]
    Other proteins in same PDB: d1mlca2, d1mlcb2, d1mlcc2, d1mlcd2, d1mlce_, d1mlcf_

Details for d1mlcc1

PDB Entry: 1mlc (more details), 2.1 Å

PDB Description: monoclonal antibody fab d44.1 raised against chicken egg-white lysozyme complexed with lysozyme

SCOP Domain Sequences for d1mlcc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mlcc1 b.1.1.1 (C:1-108) Immunoglobulin (variable domains of L and H chains) {Fab D44.1 (mouse), kappa L chain}
dieltqspatlsvtpgdsvslscrasqsisnnlhwyqqkshesprllikyvsqsssgips
rfsgsgsgtdftlsinsvetedfgmyfcqqsnswprtfgggtkleikr

SCOP Domain Coordinates for d1mlcc1:

Click to download the PDB-style file with coordinates for d1mlcc1.
(The format of our PDB-style files is described here.)

Timeline for d1mlcc1: